Glp 1是 什么 The glp 1 peptide sequence is a critical area of interest for researchers and medical professionals alike, particularly given its significant role in metabolic regulation and the development of groundbreaking therapeutic agents for conditions like type 2 diabetes and obesity. This article aims to provide a comprehensive exploration of the glp 1 peptide sequence, delving into its intricate structure, biological functions, and the implications of its various forms.
Understanding the Core GLP-1 Peptide Sequence
Glucagon-like peptide-1 (GLP-1) is a naturally occurring peptide hormone produced primarily by intestinal L cellsp43220 · glp1r_human. It is an incretin hormone, meaning it stimulates insulin secretion from the pancreas in a glucose-dependent mannerLigand ID: 1132. Synonyms:GLP-1(7-36)amide. Compound class: Endogenous peptide in human, mouse or rat. Comment: The sequence is identical in human, rat and .... The journey to understanding the glp 1 peptide sequence began with early research in the 1980s, involving the cloning of cDNAs and genes encoding proglucagon.Sequence (1-letter):HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2Storage: -20 °C or below. Glucagon-like Peptide-1 (7-36) is one the two primary biologically active ... Over time, scientists have meticulously determined the amino acid sequence of various GLP-1 forms.
The full-length human GLP-1 is a precursor moleculeGlucagon-Like Peptide (GLP) I (7-37). The biologically active forms, however, are typically truncated作者:B Manandhar·2015·被引用次数:236—(102) It has the sequence ofexendin-4and similarly showed a long circulation half-life (approximately 8 days) as 11. Another long acting GLP- .... For instance, GLP-1 (7-37) and GLP-1 (7-36) amide are recognized as the main active forms. The amino acid sequence for GLP-1 (7-36) amide is often represented in a single-letter code as HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2.Ligand ID: 1132. Synonyms:GLP-1(7-36)amide. Compound class: Endogenous peptide in human, mouse or rat. Comment: The sequence is identical in human, rat and ... This sequence is remarkably conserved across species, with identical sequences found in human, rat, and mouse.作者:C Orskov·1989·被引用次数:314—In 1988 we isolated and partly sequenced pigGLP-1and found that the NH2-terminalamino acidresidue of pig GLP-. 1 corresponds to proglucagon His7' (14). The ... Another human variant, GLP-1 (1-37), has the sequence HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG.作者:C Orskov·1989·被引用次数:314—In 1988 we isolated and partly sequenced pigGLP-1and found that the NH2-terminalamino acidresidue of pig GLP-. 1 corresponds to proglucagon His7' (14). The ...
Structural Insights and Biological Activity
The glp 1 peptide sequence dictates its three-dimensional structure and, consequently, its biological activityGlucagon-Like Peptide (GLP) I (7-36), amide, human. Active GLP-1 protein exhibits a secondary structure featuring two α-helices from amino acid position 13–20 and 24–35, separated by a linker region. This structural arrangement is crucial for its interaction with its cognate receptor, the glucagon-like peptide 1 receptor (GLP1R), a G protein-coupled receptor. Activation of the GLP-1 receptor triggers a cascade of downstream signaling events that ultimately lead to enhanced insulin secretion, suppressed glucagon release, and delayed gastric emptying.
The initial amino acid sequence of GLP-1 contains a specific structural motif at its carboxyl-terminal region: at the carboxyl-terminal region of the putative GLP-1 peptide resides a sequence RGRR.semaglutide | Ligand page This sequence is recognized by prohormone convertases, which cleave the precursor to yield the active peptide.Glucagon-Like Peptide (GLP) I (7-37)
Variations and Analogs: Enhancing Therapeutic Potential
The native GLP-1 peptide has a very short half-life in circulation, primarily due to rapid degradation by the enzyme dipeptidyl peptidase-4 (DPP-4). This limitation spurred the development of GLP-1 receptor agonists (GLP-1 RAs) with improved pharmacokinetic profiles. Numerous studies have focused on modifying the glp 1 peptide sequence to enhance its stability and efficacyGCG - Pro-glucagon - Homo sapiens (Human) | UniProtKB.
One significant development came with the investigation of peptides like exendin-4, a peptide isolated from Gila monster salivaGlucagon-Like Peptide 1 | C149H226N40O45 - PubChem - NIH. Researchers discovered that exendin-4 shares a similar biological function to GLP-1 but boasts a much longer half-life. This led to the development of exendin-4-based drugs, such as Liraglutide and Semaglutide. These therapeutic agents are GLP-1 agonists that have partial or complete amino acid sequence homology with GLP-1 found in the body, yet resist DPP-4 degradation.
Furthermore, researchers have explored the direct modification of the native GLP-1 peptide sequence. For instance, inserting a 6-aminohexanoic acid between histidine and alanine at positions 7 and 8 of the glp 1 peptide sequence has been shown to prevent N-terminal degradation. Other strategies involve creating fusion peptide molecules, such as GLP-1 (7-35, 7-36 or 7-37) sequence fused with other proteins, to prolong their duration of action.Discovery, characterization, and clinical development of ... Some advancements aim for an amino acid sequence identical to that of human origin while conferring longer half-lives.glucagon-like peptide 1-(7-36) amide | Ligand page
Clinical Significance and 'Search Intent' Relevance
The insights gained from studying the glp 1 peptide sequence have been transformative.Human Glucagon-like Peptide 1 / GLP-1 (aa 7-36) The GLP-1 (7-37) sequence, along with other active fragments like GLP-1 (7-35, 7-36 or 7-37) sequence, underpins the physiological regulation of glucose homeostasis. Understanding these sequences is vital for:
* Understanding Diabetes Management: The glucose-dependent insulinotropic action of GLP-1 makes it a prime target for type 2 diabetes treatment. GLP-1 agonists are now a cornerstone therapy, mimicking the effects of the native hormone.
* Weight Management: GLP-1 also plays a role in appetite regulation and satiety. This has led to the exploration of GLP-1 receptor agonists for weight lossSequence (1-letter):HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2Storage: -20 °C or below. Glucagon-like Peptide-1 (7-36) is one the two primary biologically active ....
* Research and Development: The detailed knowledge of the amino acid sequence is fundamental for designing novel GLP-1 analogs with enhanced properties and for understanding the structure-function relationship of the glucagon-like peptide 1 receptor.
* Fundamental Biology: The initial discovery of the GLP sequence laid the groundwork for understanding incretin biology and its impact on diverse physiological processes作者:B Manandhar·2015·被引用次数:236—(102) It has the sequence ofexendin-4and similarly showed a long circulation half-life (approximately 8 days) as 11. Another long acting GLP- ....
In summary, the glp 1 peptide sequence is more than just a string of letters; it represents a fundamental biological blueprint. From its structural features, including two α-helices from amino acid position 13–20 and 24–35, to the specific active fragments like GLP-1 (7-37) and GLP-1 (7-36) amide, this peptide holds immense significance. The ongoing research into its amino acid composition continues to unlock new therapeutic possibilities, solidifying its place as a key player in modern medicine. The detailed amino acid sequence, such as H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser and His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser, provides the granular detail necessary for this continued innovation. The broader context of GLP biology, including GLP-1 receptor interactions and comparisons like GLP1R vs GLP-1, further enriches our understanding of this vital peptide 1.
Join the newsletter to receive news, updates, new products and freebies in your inbox.